Protein Info for PP_4421 in Pseudomonas putida KT2440

Annotation: putative aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00202: Aminotran_3
  • amino acids 36 to 453 (418 residues), 286 bits, E=2.1e-89

Best Hits

Swiss-Prot: 80% identical to Y4UB_SINFN: Uncharacterized aminotransferase y4uB (NGR_a01380) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4421)

MetaCyc: 58% identical to diaminobutanoate--2-oxoglutarate transaminase (Halomonas elongata DSM 2581)

Predicted SEED Role

"Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19)" (EC 2.6.1.19)

MetaCyc Pathways

• superpathway of L-arginine and L-ornithine degradation (11/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (9/11 steps found)
• superpathway of 4-aminobutanoate degradation (3/3 steps found)
• 4-aminobutanoate degradation I (2/2 steps found)
• 4-aminobutanoate degradation II (2/2 steps found)
• 4-aminobutanoate degradation III (2/2 steps found)
• GABA shunt II (3/4 steps found)
• GABA shunt I (2/4 steps found)
• 4-aminobutanoate degradation V (2/7 steps found)
• nicotine degradation I (pyridine pathway) (5/17 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Butanoate metabolism
• Glutamate metabolism
• Propanoate metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.19

Use Curated BLAST to search for 2.6.1.19

Sequence Analysis Tools

See Q88EN3 at UniProt or InterPro

Protein Sequence (463 amino acids)

>PP_4421 putative aminotransferase (Pseudomonas putida KT2440)
MDKQKQDLISQQDRGAVLHPFTQLKDFASGKAGDPTIIETAKGITITDATGREYIDGFAG
LYCMNVGYGRTEVAEAISKQAHKLAYYHTYAAHTTEELARLSDRLVKMAPGKMSKVFYGM
SGSDANETQAKLVWYYNNLRGKPNKKKIIARERGYHGCSVVSGSMTGMSFYHDHMDLPIA
GILRTGAPHYYWGAEPGETELEFSARRARELEELILREGPDTIGAFIAEPVLGTGGITPP
PEGYWAAVQPVLKKYDILLIADEVITGFGRTGAMFGCDKYGIEPDLITVAKGLTSAYAPL
SASIVGEKVYKVMEEGADRVGAFSHGYTYSGHPIGVAAANAVLDIVEGENIPAHVDKVGQ
YFQKSMQETFSSLPIVGEVRGVGMMAAIEFVADPATKKRFDPALKVGARISKAARDRNLI
ARAMPHGEILGFAPPLVTTEQEVDRIISIAHEAVLSVLDELKV