Protein Info for PP_4404 in Pseudomonas putida KT2440

Annotation: dihydrolipoyl dehydrogenase component of branched-chain alpha-keto acid dehydrogenase complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07992: Pyr_redox_2
  • amino acids 9 to 321 (313 residues), 257 bits, E=7.8e-80
• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 9 to 459 (451 residues), 469.3 bits, E=6.5e-145
• PF13738: Pyr_redox_3
  • amino acids 10 to 305 (296 residues), 35.4 bits, E=2.2e-12
• PF01134: GIDA
  • amino acids 10 to 56 (47 residues), 22.4 bits, 1.8e-08
• PF00070: Pyr_redox
  • amino acids 174 to 240 (67 residues), 68.4 bits, E=1.9e-22
• PF02852: Pyr_redox_dim
  • amino acids 340 to 449 (110 residues), 107.9 bits, E=9.5e-35

Best Hits

Swiss-Prot: 98% identical to DLDH1_PSEPU: Dihydrolipoyl dehydrogenase (lpdV) from Pseudomonas putida

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 100% identity to ppu:PP_4404)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of branched-chain alpha-keto acid dehydrogenase (EC 1.8.1.4)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

See Q88EP9 at UniProt or InterPro

Protein Sequence (459 amino acids)

>PP_4404 dihydrolipoyl dehydrogenase component of branched-chain alpha-keto acid dehydrogenase complex (Pseudomonas putida KT2440)
MQQIIQTTLLIIGGGPGGYVAAIRAGQLGIPTVLVEGQALGGTCLNIGCIPSKALIHVAE
QFHQASRFTEPSPLGISVASPRLDIGQSVTWKDGIVDRLTTGVAALLKKHGVKVVHGWAK
VLDGKQVEVDGQRIQCEHLLLATGSSSVELPMLPLGGPVISSTEALAPKTLPQHLVVVGG
GYIGLELGIAYRKLGAQVSVVEARERILPTYDSELTAPVAESLKKLGIALHLGHSVEGYE
NGCLLASDGKGGQLRLEADQVLVAVGRRPRTKGFNLECLDLKMNGAAIAIDERCHTSMHN
VWAIGDVAGEPMLAHRAMAQGEMVAEIIAGKARRFEPTAIAAVCFTDPEVVVVGKTPEQA
SQQGLDCIVAQFPFAANGRAMSLESKSGFVRVVARRDNHLIVGWQAVGVAVSELSTAFAQ
SLEMGACLEDVAGTIHAHPTLGEAVQEAALRALGHALHI