Protein Info for PP_4398 in Pseudomonas putida KT2440

Annotation: Major facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 73 to 90 (18 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 324 to 345 (22 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 297 (287 residues), 83.6 bits, see alignment E=1.3e-27 amino acids 271 to 374 (104 residues), 33.8 bits, see alignment E=1.9e-12 PF00083: Sugar_tr" amino acids 39 to 153 (115 residues), 24.2 bits, see alignment E=1.5e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4398)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EQ5 at UniProt or InterPro

Protein Sequence (444 amino acids)

>PP_4398 Major facilitator family transporter (Pseudomonas putida KT2440)
MRNVWKPFQSLYFAALMMLIGSGLLSTYLALRLAADHVDSLWVGALMAANYFGLAVGGKV
GHRLIGRVGHIRAYATCAGIVGAAVLGHGLTSWLPAWVGLRVIVGLGMMCQYMVIESWLN
EQADVKHRGAVFSGYMIASYLGLVLGQLILVVHPQLGPELLMLVAMCFALCLVPVAMTRR
IHPAPLRPAPMEPKFFIKRVPQSLSTVLGSGLIVGSFYGLAPLYASSQGMSTEQIGLFMG
SCIFAGLLVQWPLGWLSDRYDRAVLIRSVAVGLALAAAPLAILPSVPLELLFGIGFLISL
LQFCLYPLAVAFSNDHVESERRVSLTAMLLVTYGVGACVGPLAAGVLMKVLGAQMLYAFF
VFFALVLVWRIRPKAVTGLHQVQDAPLGHVAMPAAGSPLSAALDPRVDEQTVQDVMQAPV
AAEDTEDEEKGAQQQAPEEVSKSV