Protein Info for PP_4393 in Pseudomonas putida KT2440

Annotation: putative chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF01584: CheW" amino acids 21 to 156 (136 residues), 126.1 bits, see alignment E=7.6e-41 PF00072: Response_reg" amino acids 182 to 301 (120 residues), 59.7 bits, see alignment E=3e-20

Best Hits

KEGG orthology group: K03415, two-component system, chemotaxis family, response regulator CheV (inferred from 100% identity to ppf:Pput_1461)

Predicted SEED Role

"Chemotaxis protein CheV (EC 2.7.3.-)" in subsystem Bacterial Chemotaxis or Flagellar motility (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88ER0 at UniProt or InterPro

Protein Sequence (309 amino acids)

>PP_4393 putative chemotaxis protein (Pseudomonas putida KT2440)
MAGVMDSVNQRTQLVGQNRLELLLFRLNGEQLYGINVFKVREVLQCPALTLLPKAHPVVR
GVANIRGATIPILDLSMATGLRPLQEDTRNSFVIITEYNTKTQGFLVHSVERIVNMNWEE
IHPPPKGTGRDHYLTAVTRVDNRMVEIIDVEKVLAEVSPSSESVSAGVIDAEVQDKAVLM
RVLTVDDSSVARKQVSRCLQTVGVEVVALNDGRQALNYLRQLVDEGKKPEEEFLMMISDI
EMPEMDGYTLTAEIRSDPRMQKLHICLHTSLSGVFNQAMVKKVGADDFLAKFKPDDLAQR
VVDRIKAAH