Protein Info for PP_4389 in Pseudomonas putida KT2440

Annotation: Flagellar basal-body rod modification protein FlgD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF03963: FlgD" amino acids 17 to 84 (68 residues), 79.4 bits, see alignment E=2.9e-26 PF13861: FLgD_tudor" amino acids 93 to 229 (137 residues), 60 bits, see alignment E=3.1e-20 PF13860: FlgD_ig" amino acids 117 to 186 (70 residues), 78.1 bits, see alignment E=6.2e-26

Best Hits

KEGG orthology group: K02389, flagellar basal-body rod modification protein FlgD (inferred from 100% identity to ppu:PP_4389)

Predicted SEED Role

"Flagellar basal-body rod modification protein FlgD" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88ER4 at UniProt or InterPro

Protein Sequence (233 amino acids)

>PP_4389 Flagellar basal-body rod modification protein FlgD (Pseudomonas putida KT2440)
MTTTNSTTDVGSAYLTSLQKQTSKTDSSTGAAGSALGKDAFLQLLVTQMQNQNPLDPQEN
GEFVAQLAQFSSLESMQSLNDAVTYIAAGLQSSQALQASSLVGRNVIVQTDKAVVDTSKD
MKGSVNLTSSSTSTSVGIYDKDDKLVRTIELGTQKSGSIDFTWDGLNDDGEVAAAGTYTF
KATASIDGKATAMTTNLPASVTSVTMGSNGSEMTLNLAGLGSVALSKIQSIGI