Protein Info for PP_4382 in Pseudomonas putida KT2440

Annotation: Peptidoglycan hydrolase FlgJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 TIGR02541: flagellar rod assembly protein/muramidase FlgJ" amino acids 17 to 370 (354 residues), 271.7 bits, see alignment E=5.8e-85 PF10135: Rod-binding" amino acids 53 to 104 (52 residues), 52.9 bits, see alignment 4.5e-18 PF01832: Glucosaminidase" amino acids 232 to 370 (139 residues), 128.1 bits, see alignment E=3.2e-41

Best Hits

KEGG orthology group: K02395, flagellar protein FlgJ (inferred from 100% identity to ppu:PP_4382)

Predicted SEED Role

"Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-)" in subsystem Flagellum (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88ES1 at UniProt or InterPro

Protein Sequence (384 amino acids)

>PP_4382 Peptidoglycan hydrolase FlgJ (Pseudomonas putida KT2440)
MNIKSQVSGSADSGAYTDLNRLSALKHGDRDSEANVRKVAQEFESLFISEMLKASRKASD
VLADDNPMNTETVKQYRDMYDQQLAVSMSREGGGIGLQDVLVRQLTKGRSASINTSPFPR
VDSGGPALWGNKVAEPAHAMASSATRNDVAALNARRLALPSKLTDRLLAGIVPSAETANN
AAVPARDGQAVAKAFAVPDNGLRIVGRAVAQPPLAPNKAFTDSDAFVATMLPMAEQAARR
IGVDPRYLVAQAALETGWGKSVMRNSDGSSSHNLFGIKATGNWQGEQARAITSEFRDGQF
VKETAAFRSYDSYQDSFHDLVTLLQSNARYQGALDAADNPEQFARELQKAGYATDPGYAK
KIISIAQQMQSTPQYAMAGRTTNL