Protein Info for PP_4371 in Pseudomonas putida KT2440

Annotation: two component system AtoC DNA-binding transcriptional activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 PF00072: Response_reg" amino acids 5 to 114 (110 residues), 104.1 bits, see alignment E=2e-33 PF00158: Sigma54_activat" amino acids 132 to 294 (163 residues), 238.4 bits, see alignment E=1.5e-74 PF14532: Sigma54_activ_2" amino acids 142 to 294 (153 residues), 73.5 bits, see alignment E=8.6e-24 PF00004: AAA" amino acids 152 to 271 (120 residues), 21.3 bits, see alignment E=1.2e-07 PF07728: AAA_5" amino acids 152 to 270 (119 residues), 32.5 bits, see alignment E=3.3e-11 PF02954: HTH_8" amino acids 401 to 437 (37 residues), 48.2 bits, see alignment 2.8e-16

Best Hits

Swiss-Prot: 45% identical to ZRAR_ECO57: Transcriptional regulatory protein ZraR (zraR) from Escherichia coli O157:H7

KEGG orthology group: K10943, two component system, response regulator FlrC (inferred from 100% identity to ppu:PP_4371)

Predicted SEED Role

"Flagellar regulatory protein FleQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88ET2 at UniProt or InterPro

Protein Sequence (451 amino acids)

>PP_4371 two component system AtoC DNA-binding transcriptional activator (Pseudomonas putida KT2440)
MAIKVLLVEDDRVLRQALGDTLEIGGFAYQAVGSAEEALEAVLEDAFSLVVSDVNMPGMD
GHQLLSQLRRQQPQLPVLLMTAHAAVERAVEAMRQGAADYLVKPFEPKALLNLVERHAAG
RVTGEEGPVACEPASRQLLELAARVARSDSTVLISGESGTGKEVLARYIHQQSPRAAQPF
VAINCAAIPDNMLEATLFGHEKGAFTGAIAAQAGKFEQAEGGTLLLDEISEMPMALQAKL
LRVLQEREVERVGGRKPISLDIRVLATTNRDLAGEVAAGRFREDLYYRLSVFPLAWRPLR
ERPGDILQLAERLLARHVAKMKHASVRLSPAARACLQAYAWPGNVRELDNALQRALILQQ
GGVIEAADFCLAGAIPLSAGTEPSLEVVADAGGLGDDMRRHEYQMIIDTLRAERGRRKEA
AERLGISPRTLRYKLAQMRDAGFDVEASLFG