Protein Info for PP_4369 in Pseudomonas putida KT2440

Annotation: Flagellar M-ring protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 490 to 511 (22 residues), see Phobius details TIGR00206: flagellar M-ring protein FliF" amino acids 37 to 591 (555 residues), 321.9 bits, see alignment E=5.1e-100 PF01514: YscJ_FliF" amino acids 61 to 237 (177 residues), 222.4 bits, see alignment E=4.1e-70 PF08345: YscJ_FliF_C" amino acids 270 to 468 (199 residues), 147.3 bits, see alignment E=4.8e-47

Best Hits

Swiss-Prot: 76% identical to FLIF_PSEAE: Flagellar M-ring protein (fliF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02409, flagellar M-ring protein FliF (inferred from 100% identity to ppu:PP_4369)

Predicted SEED Role

"Flagellar M-ring protein FliF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88ET4 at UniProt or InterPro

Protein Sequence (592 amino acids)

>PP_4369 Flagellar M-ring protein (Pseudomonas putida KT2440)
MAEAVVENAPAKAGSPAAKPPLFGMAFLENISQMPMLRQIGLLVGLAASVAIGFAVVLWS
QQPDYRPLYGSLSGMDTKQVMDTLAAADIPYNVEPNSGALLVKADDLSRARLKLAAAGVA
PSDGNVGFELLDKEQGLGTSQFMEATRYRRSLEGELARTVSSLNNVKAARVHLAIPKSSV
FVRDERKPSASVLVELYPGRALEAGQVMAIVNLVATSVPELDKSQVTVVDQKGNLLSEQI
QDSALTQAGKQFDYSRRVESMLTQRVHNILQPVLGNDRYKAEVSADLDFSAVESTSEQFN
PDQPALRSEQSVDEQRASSQGPQGVPGALSNQPPGAASAPQTTGGAATPAAAIQPGQPLV
DANGQQIMDPATGQPMLAPYPSDKRQQSTKNFELDRSISHTRQQQGRMARLSVAVVVDDQ
VKIDPATGDTTRAPWGAEDLARFTRLVQDAVGFDASRGDSVTVINVPFAADRGEEIADIA
FYQQPWFWDIVKQVLGVVFILVLVFGVLRPVLNNITGGGKQAAPDSDMELGGMMGLDGEL
ANDRVSLGGPTSILLPSPSEGYEAQLNAIKGLVAEDPGRVAQVVKDWINADE