Protein Info for PP_4348 in Pseudomonas putida KT2440

Annotation: putative Cystathionine beta-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF01053: Cys_Met_Meta_PP" amino acids 30 to 362 (333 residues), 199 bits, see alignment E=4.7e-63

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4348)

Predicted SEED Role

"Cystathionine beta-lyase (EC 4.4.1.8)" in subsystem Methionine Biosynthesis (EC 4.4.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EV4 at UniProt or InterPro

Protein Sequence (364 amino acids)

>PP_4348 putative Cystathionine beta-lyase (Pseudomonas putida KT2440)
MECTSYLVDTFDQLPPINEESLADIDNDLFSGLYYGGVDTPTTRQLSQRVADLEKGKFAV
LTPSGQSAFNLLLTTFVKPGDHVLAGDTIVYSTRWLLNHFENIGVKIEYFTPSEAATLKN
KLTLKTKLIIFENPGAFTYEVMDISAIVESRHDHPALIVADNTWAASLFHHPLSLGADIS
LISMSKYHGAVEGISLGALITKRKDLYVNLKTTSALTGNHVSSHACSAAIRSISTLGARL
SFQMSTTRKVLRSLKPLPLLKQAIHPILQNTELHLQNSMIYGFNSLFTAEFSCSRNELIS
RLNRLNLIKIGYGWGGTTSLVNLIDTHDMPSAKRLGINSECARIYLGLEDPDELTRDLTN
AFTQ