Protein Info for PP_4327 in Pseudomonas putida KT2440

Annotation: Cytochrome c biogenesis ATP-binding export protein CcmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01189: heme ABC exporter, ATP-binding protein CcmA
  • amino acids 5 to 205 (201 residues), 268.7 bits, E=1.4e-84
• PF00005: ABC_tran
  • amino acids 21 to 160 (140 residues), 106.2 bits, E=2.2e-34

Best Hits

Swiss-Prot: 100% identical to CCMA_PSEPK: Cytochrome c biogenesis ATP-binding export protein CcmA (ccmA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02193, heme exporter protein A [EC: 3.6.3.41] (inferred from 100% identity to ppg:PputGB1_3896)

MetaCyc: 53% identical to cytochrome c maturation protein A (Escherichia coli K-12 substr. MG1655)
RXN-21408

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

• cytochrome c biogenesis (system I type) (7/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.41

Sequence Analysis Tools

See Q88EX5 at UniProt or InterPro

Protein Sequence (210 amino acids)

>PP_4327 Cytochrome c biogenesis ATP-binding export protein CcmA (Pseudomonas putida KT2440)
MTLHLQAAGLACERDWRLLFEQLDFELGAGDMLQISGPNGSGKTSLLRLLAGLMQPTAGQ
ILLGGKPLAEQRHALASALLWIGHAAGIKDLLTAEENLTWLCALHQPASREAIWAALEAV
GLRGFEDVPCHTLSAGQQRRVALARLHLACPPLWILDEPFTALDKQGVAQLEAHLAAHCE
QGGTVVLTTHHTLERKPSGYRELNLGQWAA