Protein Info for PP_4324 in Pseudomonas putida KT2440

Annotation: Heme exporter protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 58 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details TIGR03141: heme exporter protein CcmD" amino acids 10 to 56 (47 residues), 71.4 bits, see alignment E=2.5e-24 PF04995: CcmD" amino acids 13 to 55 (43 residues), 63 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 83% identical to CCMD_PSEAE: Heme exporter protein D (ccmD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02196, heme exporter protein D (inferred from 98% identity to ppg:PputGB1_3893)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmD, interacts with CcmCE" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EX8 at UniProt or InterPro

Protein Sequence (58 amino acids)

>PP_4324 Heme exporter protein D (Pseudomonas putida KT2440)
MSFATFGDFLAMGHHGLYVWSAYGICLAVLALNVGAPLLARRRYLQEEARRLRRENNQ