Protein Info for PP_4321 in Pseudomonas putida KT2440

Annotation: holocytochrome c synthetase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR00385: periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily" amino acids 6 to 169 (164 residues), 193.7 bits, see alignment E=9.8e-62 PF00578: AhpC-TSA" amino acids 36 to 150 (115 residues), 62.7 bits, see alignment E=6.9e-21 PF08534: Redoxin" amino acids 37 to 156 (120 residues), 86.2 bits, see alignment E=4.2e-28 PF13098: Thioredoxin_2" amino acids 59 to 162 (104 residues), 32.3 bits, see alignment E=2.1e-11

Best Hits

Swiss-Prot: 76% identical to DSBE_PSEFC: Thiol:disulfide interchange protein DsbE (dsbE) from Pseudomonas fluorescens biotype C

KEGG orthology group: K02199, cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE (inferred from 98% identity to ppg:PputGB1_3890)

MetaCyc: 56% identical to thiol:disulfide oxidoreductase CcmG (Escherichia coli K-12 substr. MG1655)
1.8.4.-; RXN-21424; RXN-21425

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EY1 at UniProt or InterPro

Protein Sequence (178 amino acids)

>PP_4321 holocytochrome c synthetase subunit (Pseudomonas putida KT2440)
MKRWIMVVPLAVFLLVAVFLYKGLFLKPDELPSAMIGKPFPAFSLASTQGDRTLTQADLQ
GRPALVNVWATWCPSCKVEHPYLNQLAQQGVVIHGVNYKDDNTAAQKWLAEFHNPYQLDI
RDEQGSLGLDLGVYGAPETFLIDAKGIIRYKHVGIVDATVWREQLAPLYQGLIDEAKP