Protein Info for PP_4309 in Pseudomonas putida KT2440

Annotation: Transporter, NCS1 nucleoside transporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 transmembrane" amino acids 72 to 100 (29 residues), see Phobius details amino acids 132 to 157 (26 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 328 to 356 (29 residues), see Phobius details amino acids 368 to 385 (18 residues), see Phobius details amino acids 391 to 410 (20 residues), see Phobius details amino acids 444 to 463 (20 residues), see Phobius details amino acids 469 to 488 (20 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 46 to 477 (432 residues), 263.8 bits, see alignment E=1.4e-82

Best Hits

KEGG orthology group: K03457, nucleobase:cation symporter-1, NCS1 family (inferred from 100% identity to ppu:PP_4309)

Predicted SEED Role

"Hydantoin permease" in subsystem Hydantoin metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EZ1 at UniProt or InterPro

Protein Sequence (510 amino acids)

>PP_4309 Transporter, NCS1 nucleoside transporter family (Pseudomonas putida KT2440)
MSSSLDLAPELSVASTHPASTLAGHQPDLVLSPRLHNRDLAPTRMEGRRWGGYSIFALWT
NDVHNIANYSFAMGLFALGLGGWQILLSLAIGAALVYFFMNLSGYMGQKTGVPFPVISRI
AFGIHGAQIPALIRAVIAIAWFGIQTYLASVVLRVLLTAVWPQIAAYDHDSILGLSSLGW
VCFVSIWLVQLVILAYGMEMVRRYEAFAGPVILLTVAALAVFMYFKADARIAWSVATPLT
GYEMWRNIFAGGALWLAIYGTLVLNFCDFARSSPCRKTIRVGNFWGLPVNILVFAVITVV
LCGAQFQINGQIIDSPTQIVAAIPSTPFLVLGCLAFLIVTVAVNIMANFVAPAFVLSNLA
PRHLNFRRAGLISATLAVLILPWNLYNSPLVIVYFLSGLGALLGPLYGVIMSDYWLLRKG
CINVPELYTEHPAGAYHYSKGINLRAVAAFVPAALLAIVLALVPNFQGIAPFSWLIGAGI
AAALYLLIAPRNRHYHDVSGECIAVDHSGH