Protein Info for PP_4304 in Pseudomonas putida KT2440

Annotation: Cation transporter, VIC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 29 to 46 (18 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 185 to 202 (18 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details PF00520: Ion_trans" amino acids 25 to 237 (213 residues), 109.8 bits, see alignment E=1.3e-35 PF07885: Ion_trans_2" amino acids 158 to 232 (75 residues), 56.1 bits, see alignment E=2.8e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4304)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EZ6 at UniProt or InterPro

Protein Sequence (273 amino acids)

>PP_4304 Cation transporter, VIC family (Pseudomonas putida KT2440)
MQTPQSIRERLFVIVFQTDTVAGRRFDKILLLIILASLVTVILDSIDEVHQGYAGLLAGI
EWGFTAIFLAEYITRLYCSPKPLRYAFSFYGLVDLLAIVPGILALYYSDAQYLLIIRVIR
MLRIFRVLKLSPYLKQAHYLMEALRGSKQKIIVFLVTVSTLVTVFGTLMYVIEGPEHGFT
SIPKGIYWAIVTLTTVGFGDIVPKTPLGQVLSSLVMITGYSIIAVPTGIFTAELANAMRG
EQLQHDCPTCHKKTHEQGAAFCSRCGNGLFPKA