Protein Info for PP_4300 in Pseudomonas putida KT2440

Annotation: putative hydroxypyruvate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 PF13660: DUF4147" amino acids 9 to 228 (220 residues), 299 bits, see alignment E=2.4e-93 PF05161: MOFRL" amino acids 307 to 412 (106 residues), 120.4 bits, see alignment E=3.9e-39

Best Hits

KEGG orthology group: K00050, hydroxypyruvate reductase [EC: 1.1.1.81] (inferred from 100% identity to ppu:PP_4300)

Predicted SEED Role

"D-glycerate 2-kinase (EC 2.7.1.-)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism or Entner-Doudoroff Pathway (EC 2.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.81, 2.7.1.-

Use Curated BLAST to search for 1.1.1.81 or 2.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88F00 at UniProt or InterPro

Protein Sequence (424 amino acids)

>PP_4300 putative hydroxypyruvate reductase (Pseudomonas putida KT2440)
MSVDPQKLLRELFDTAIAAAHPRQVLEPYLPADRSGRVIVIGAGKAAAAMAEVVEKSWQG
EVSGLVVTRYGHGANCQKIEVVEAAHPVPDAAGLAVAKRVLELVSNLNEEDRVIFLLSGG
GSALLALPAEGLTLADKQQINKALLKSGATIGEMNCVRKHLSAIKGGRLAKACWPATVYT
YAISDVPGDLATVIASGPTVADPSTSADALAILKRYNIEAPKAVIDWLNNPASETVKADD
PALARSHFQLIAKPQQSLEAAAVKARQAGFSPLILGDLEGESREVAKVHAGIARQIVQHG
QPLKAPCVILSGGETTVTVRGNGRGGRNAEFLLSLTESLKGLPGVYALAGDTDGIDGSEE
NAGAFMTPASYASAEALGLSASDELDNNNGYGYFAALDALIVTEPTRTNVNDFRAILILE
TAQS