Protein Info for PP_4289 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 225 to 242 (18 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details PF06181: Urate_ox_N" amino acids 4 to 293 (290 residues), 425.1 bits, see alignment E=7.9e-132

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4289)

Predicted SEED Role

"FIG137887: membrane protein related to purine degradation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88F11 at UniProt or InterPro

Protein Sequence (446 amino acids)

>PP_4289 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MEAHLHEWLNLSIRWVHMITGVAWIGASFYFVWLENHLNRSNPRDGLSGDLWAIHGGGIY
HLEKYKLAPPKMPENLHWFKWEAYFTWMSGIALLCVVFYWNPTLYLLAPGSTLSGAEGVA
IGIGSLIAGWFIYDFLCDSPLGKKPALLGAVLFVLIIAACWGFSLVFSGRGAYLHTGAII
GTIMVGNVFRIIMPAQRQLVAAIENNQTPDPVLPAKGLLRSRHNNYFTLPVLFIMISNHF
PSTYGSQYNWLILAGIAVAAVLIRHYFNTRHDSNKYAWTLPVGALAMICLAYVTGPKPIA
VSPEQAAAKIEYQPLPATAVGGKTAAEQRAEDAAKAAEAPAAPAQAPAQAAAQAAAQAGG
GEFDKIHNVIQERCTVCHSSKPTSPLFSTAPAGVMFDTPQQIQAQAARIQAQAVASQIMP
LGNITQMTTEERKLVGDWIAKGAQVN