Protein Info for PP_4284 in Pseudomonas putida KT2440

Annotation: putative Transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 39 to 57 (19 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details amino acids 248 to 271 (24 residues), see Phobius details amino acids 309 to 324 (16 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 362 to 385 (24 residues), see Phobius details amino acids 392 to 420 (29 residues), see Phobius details amino acids 431 to 448 (18 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 37 to 410 (374 residues), 169.2 bits, see alignment E=6e-54

Best Hits

Swiss-Prot: 50% identical to ADEP_ECOLI: Adenine permease AdeP (adeP) from Escherichia coli (strain K12)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 99% identity to ppg:PputGB1_3848)

MetaCyc: 50% identical to adenine:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-447

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88F15 at UniProt or InterPro

Protein Sequence (449 amino acids)

>PP_4284 putative Transporter (Pseudomonas putida KT2440)
MESRKSEAPTLDLAPPLETSWLERIFKLKQHGSTVRTEMIAGVTTFITMAYIIFVNPNIM
ADAGIDHGAAFVATCIAAALGCLLMGLYANWPVGLAPGMGLNAFFTYTVVGTMGYNWETA
LGAVFVSGVLFMFLTLSKVREWLLNSIPVSLRHAMGAGVGLFLGLIGLKTAGIIVDSPAT
LIKLGSLHEPGPLLAAVCFLLIAILSYKRVFGAILISIMGVTLAGWGLGLVKFGGVMSMP
PSLAPTWMAMDVAGVFNVSMISVVLAFLFVHMFDTAGTLMGVAQRANLVAPDGRIENLSK
ALKADSASSVFGAVVGVPPVTSYVESAAGVAAGGRTGLTAVVVGLLFIAAMFFAPLAGMI
PAYATAGALIYVAMLMMGSMAHIHWDEATDSIPAIVTVIMMPLTFSVADGIALGFISYVA
LKAGTGKYKEISASLWVLCAIFIAKFVFL