Protein Info for PP_4275 in Pseudomonas putida KT2440

Annotation: putative cell division protein ZipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 28 to 45 (18 residues), see Phobius details TIGR02205: cell division protein ZipA" amino acids 25 to 305 (281 residues), 259.6 bits, see alignment E=2.9e-81 PF04354: ZipA_C" amino acids 178 to 304 (127 residues), 159.9 bits, see alignment E=1.4e-51

Best Hits

Swiss-Prot: 100% identical to ZIPA_PSEPK: Cell division protein ZipA (zipA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03528, cell division protein ZipA (inferred from 100% identity to ppu:PP_4275)

Predicted SEED Role

"Cell division protein ZipA" in subsystem Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88F24 at UniProt or InterPro

Protein Sequence (317 amino acids)

>PP_4275 putative cell division protein ZipA (Pseudomonas putida KT2440)
MLKGFEPFVFKHIFIEARDYMEIGLREWLILIGIIVIAGILFDGWRRMRGGKGKLKFRLD
RSYSNLPDEEGGSAEVLGPSRVLDTHKEPELDESDLPSLSASARDREREPKPVKASKRGK
RASAAADVHQGDLNLSAEPREPDLFSDSDDDFAADNNRSSGAAPASNSVKELPPAEEVLV
ISVISRDEGGFKGPALLQNILESGLRFGEMDIFHRHESMAGHGEVLFSMANAVKPGVFDL
DDIDHFSTRAVSFFLGLPGPRHPKQAFDVMVAAARKLAHELNGELKDDQRSVLTAQTIEH
YRQRIVEFERRALTQKR