Protein Info for PP_4257 in Pseudomonas putida KT2440
Annotation: cytochrome c oxidase subunit, cbb3-type
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00407, cb-type cytochrome c oxidase subunit IV [EC: 1.9.3.1] (inferred from 100% identity to ppf:Pput_1611)MetaCyc: 100% identical to cbb3-2 cytochrome c oxidase subunit Q (Pseudomonas putida KT2440)
Predicted SEED Role
"Cytochrome c oxidase subunit CcoQ (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)
MetaCyc Pathways
- aerobic respiration I (cytochrome c) (3/4 steps found)
- aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
- arsenite to oxygen electron transfer (1/2 steps found)
- arsenite to oxygen electron transfer (via azurin) (1/3 steps found)
- Fe(II) oxidation (3/6 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.9.3.1
Use Curated BLAST to search for 1.9.3.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q88F42 at UniProt or InterPro
Protein Sequence (63 amino acids)
>PP_4257 cytochrome c oxidase subunit, cbb3-type (Pseudomonas putida KT2440) MDIGMIRGLGTVVVMVAFVGLALWVFNPRRKKDFDEATQLPFADDPEATRHVEQAKASGS KQQ