Protein Info for PP_4248 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function, UPF0345 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 94 PF06865: Ppnp" amino acids 3 to 92 (90 residues), 129.8 bits, see alignment E=2.1e-42

Best Hits

Swiss-Prot: 100% identical to PPNP_PSEP1: Pyrimidine/purine nucleoside phosphorylase (ppnP) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K09913, hypothetical protein (inferred from 100% identity to ppf:Pput_1620)

Predicted SEED Role

"FIG074102: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88F51 at UniProt or InterPro

Protein Sequence (94 amino acids)

>PP_4248 conserved protein of unknown function, UPF0345 family (Pseudomonas putida KT2440)
MFQVNEYFNGTVKSIAFSGEEGPATVGVMAPGEYEFGTAKREIMHVVSGALTVKLPGSDN
WETFNAGDKFNVPADSKFQLQVKVDTAYLCEYRD