Protein Info for PP_4224 in Pseudomonas putida KT2440

Annotation: Sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details PF08521: 2CSK_N" amino acids 16 to 146 (131 residues), 25.7 bits, see alignment E=2.6e-09 PF26769: HAMP_PhoQ" amino acids 174 to 217 (44 residues), 28 bits, see alignment 4.3e-10 PF00512: HisKA" amino acids 226 to 286 (61 residues), 44.4 bits, see alignment E=3.6e-15 PF02518: HATPase_c" amino acids 340 to 436 (97 residues), 71.7 bits, see alignment E=1.7e-23 PF13581: HATPase_c_2" amino acids 345 to 429 (85 residues), 30.4 bits, see alignment E=8.6e-11

Best Hits

KEGG orthology group: K02484, two-component system, OmpR family, sensor kinase [EC: 2.7.13.3] (inferred from 100% identity to ppu:PP_4224)

Predicted SEED Role

"Sensor histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88F74 at UniProt or InterPro

Protein Sequence (440 amino acids)

>PP_4224 Sensor histidine kinase (Pseudomonas putida KT2440)
MSLRVRLSLILGSAFVIIWALAAAWMLRDLRQQMMFSLDQRLVASARMVAGLIDQLPQPL
TAKGGEAHFSADQFSVPDGMACQVSSLRGEILASNHKHDGAMDDERSGFRDQTIDDALWR
TFTYNHGDVRITTADRHMEREALNQSILLAASAPVLMALLGSLGLLWIGLGKGLEPLNRM
RDALRRRRADSVEPLQVAGMPSELQPLLETQNQLFLRIAQTLERERRLTDDAAHELRSPL
TAIKTHLQVARMTDGAVREQALEHAEQGTDRMHRTLEQLLMLARVEGSLSFEDGVQCSAE
QVARQAVQDAGGGDNRRILLRLPEEATQIYLGMPAPLAVAALRNLLDNALRHGGDEAVEL
EVQMADGQVGFMVRDHGPGIAEADLEHLTERFWRNGQSGGCGLGLAIVQAIVQRCAGSLR
FDSRSDGLRVLLQVPARPGH