Protein Info for PP_4210 in Pseudomonas putida KT2440

Annotation: pyoverdine efflux carrier and ATP binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 transmembrane" amino acids 282 to 302 (21 residues), see Phobius details amino acids 530 to 554 (25 residues), see Phobius details amino acids 582 to 606 (25 residues), see Phobius details amino acids 612 to 636 (25 residues), see Phobius details PF00005: ABC_tran" amino acids 26 to 174 (149 residues), 109.6 bits, see alignment E=3e-35 PF12704: MacB_PCD" amino acids 281 to 498 (218 residues), 151.2 bits, see alignment E=7.3e-48 PF02687: FtsX" amino acids 535 to 647 (113 residues), 60.9 bits, see alignment E=1.9e-20

Best Hits

Swiss-Prot: 100% identical to MACB_PSEPK: Macrolide export ATP-binding/permease protein MacB (macB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K05685, macrolide transport system ATP-binding/permease protein [EC: 3.6.3.-] (inferred from 100% identity to ppu:PP_4210)

Predicted SEED Role

"Pyoverdine efflux carrier and ATP binding protein" in subsystem Siderophore Pyoverdine

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88F88 at UniProt or InterPro

Protein Sequence (654 amino acids)

>PP_4210 pyoverdine efflux carrier and ATP binding protein (Pseudomonas putida KT2440)
MATPLIELCDIRKAYGGVDTPRVEVLRGISLRVHAGEFVAIVGASGSGKSTLMNILGCLD
RPSAGSYRFAGKDVAELDSDELAWLRREAFGFVFQGYHLIPSGSAQENVEMPAIYAGTPA
AERQARASALLGRLGLASRTANRPHQLSGGQQQRVSIARALMNGGHIILADEPTGALDSH
SGAEVMALLDELASQGHVIILITHDREVAARAHRVIEIRDGLVISDSAADQPPAHAHKGI
QAEELRQRLDRGATQHGAWKGELLESLQAAWRVMWINRFRTALTLLGIIIGVASVVVMLA
VGEGSKRQVMAQMAAFGSNILYLNGSPPTLREPAGRITLDDVAAIGELPQVKHIMPVLGE
KMMVRHGNNSQQFYVGGNNTFFPEIFNWPAVEGSFFTETDEASSAAVAVIGQKVREKMLA
PGSNPIGQYLLIGNVPFQVVGILAGKGASSGDQDSDGRIVVPFSAAAIRLFGHRDPDYIA
IAARDSGQVKDTEAAIDRLLRQRHQGKHDFELTNDAALIQAEARTQNSLSLMLGAIAAIS
LLVGGIGVMNIMLMTVRERTREIGIRMATGARQRDILRQFLSEAIMLSMVGGLTGIALAL
VVGASLTLADIAVAFALPAIVGAFACAVITGVVFGFMPARKAARLDPVKALTSE