Protein Info for PP_4193 in Pseudomonas putida KT2440

Annotation: succinate dehydrogenase membrane b-556 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01127: Sdh_cyt
  • amino acids 6 to 122 (117 residues), 108.1 bits, E=1.6e-35
• TIGR02970: succinate dehydrogenase, cytochrome b556 subunit
  • amino acids 8 to 126 (119 residues), 138 bits, E=8.7e-45

Best Hits

Swiss-Prot: 55% identical to DHSC_ECO57: Succinate dehydrogenase cytochrome b556 subunit (sdhC) from Escherichia coli O157:H7

KEGG orthology group: K00241, succinate dehydrogenase cytochrome b-556 subunit (inferred from 99% identity to ppw:PputW619_3516)

MetaCyc: 100% identical to succinate dehydrogenase membrane b556 subunit (Pseudomonas putida KT2440)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Succinate dehydrogenase cytochrome b-556 subunit" in subsystem Succinate dehydrogenase

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• partial TCA cycle (obligate autotrophs) (8/8 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (8/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• TCA cycle VII (acetate-producers) (8/9 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• TCA cycle VI (Helicobacter) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
• TCA cycle III (animals) (7/10 steps found)
• glycerol-3-phosphate to fumarate electron transfer (1/2 steps found)
• succinate to cytochrome bd oxidase electron transfer (1/2 steps found)
• reductive TCA cycle I (7/11 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• pyruvate fermentation to propanoate I (2/7 steps found)
• reductive TCA cycle II (5/12 steps found)
• methylaspartate cycle (10/19 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)
• L-glutamate degradation VIII (to propanoate) (2/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Oxidative phosphorylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.5.1

Sequence Analysis Tools

See Q88FA5 at UniProt or InterPro

Protein Sequence (128 amino acids)

>PP_4193 succinate dehydrogenase membrane b-556 subunit (Pseudomonas putida KT2440)
MKKAVKSQRPVNLDLRTIKLPVTAYTSILHRISGVILFIGLAIMLYALGKSLGSEEGFGE
VKACLTSPLAKFVTWGLLSALLYHLVAGVRHLIMDMGIGETLEGGKLGSKIVIVISVVLI
VLVGVWVW