Protein Info for PP_4187 in Pseudomonas putida KT2440

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 4 to 472 (469 residues), 543.7 bits, E=1.7e-167
• PF07992: Pyr_redox_2
  • amino acids 5 to 334 (330 residues), 254.3 bits, E=8.3e-79
• PF12831: FAD_oxidored
  • amino acids 6 to 38 (33 residues), 30.1 bits, see alignment (E = 1.6e-10)
• PF01134: GIDA
  • amino acids 6 to 61 (56 residues), 24.7 bits, 6e-09
• PF00890: FAD_binding_2
  • amino acids 6 to 47 (42 residues), 31.9 bits, 4.3e-11
• PF13738: Pyr_redox_3
  • amino acids 138 to 318 (181 residues), 32.6 bits, E=2.7e-11
• PF00070: Pyr_redox
  • amino acids 183 to 259 (77 residues), 65.8 bits, E=2e-21
• PF02852: Pyr_redox_dim
  • amino acids 353 to 462 (110 residues), 141.5 bits, E=6e-45

Best Hits

Swiss-Prot: 100% identical to DLDH2_PSEPU: Dihydrolipoyl dehydrogenase (lpdG) from Pseudomonas putida

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 99% identity to pen:PSEEN3638)

MetaCyc: 48% identical to dihydrolipoyl dehydrogenase subunit (Syntrophotalea carbinolica DSM 2380)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

See Q88FB1 at UniProt or InterPro

Protein Sequence (478 amino acids)

>PP_4187 dihydrolipoyl dehydrogenase (Pseudomonas putida KT2440)
MTQKFDVVVIGAGPGGYVAAIKAAQLGLKTACIEKYTDAEGKLALGGTCLNVGCIPSKAL
LDSSWKYKEAKESFNVHGISTGEVKMDVAAMVGRKAGIVKNLTGGVATLFKANGVTSIQG
HGKLLAGKKVEVTKADGTTEVIEAENVILASGSRPIDIPPAPVDQNVIVDSTGALEFQAV
PKRLGVIGAGVIGLELGSVWARLGAEVTVLEALDTFLMAADTAVSKEAQKTLTKQGLDIK
LGARVTGSKVNGNEVEVTYTNAEGEQKITFDKLIVAVGRRPVTTDLLASDSGVTIDERGY
IFVDDYCATSVPGVYAIGDVVRGMMLAHKASEEGIMVVERIKGHKAQMNYDLIPSVIYTH
PEIAWVGKTEQALKAEGVEVNVGTFPFAASGRAMAANDTGGFVKVIADAKTDRVLGVHVI
GPSAAELVQQGAIAMEFGTSAEDLGMMVFSHPTLSEALHEAALAVNGGAIHVANRKKR