Protein Info for PP_4186 in Pseudomonas putida KT2440

Annotation: succinyl-CoA synthetase, beta subunit glutaryl-CoA synthetase, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 TIGR01016: succinate-CoA ligase, beta subunit" amino acids 1 to 385 (385 residues), 573.9 bits, see alignment E=7.9e-177 PF08442: ATP-grasp_2" amino acids 2 to 203 (202 residues), 275 bits, see alignment E=5.3e-86 PF13549: ATP-grasp_5" amino acids 3 to 218 (216 residues), 44.6 bits, see alignment E=1.7e-15 PF00549: Ligase_CoA" amino acids 262 to 382 (121 residues), 115.1 bits, see alignment E=3.9e-37

Best Hits

Swiss-Prot: 100% identical to SUCC_PSEP1: Succinate--CoA ligase [ADP-forming] subunit beta (sucC) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K01903, succinyl-CoA synthetase beta subunit [EC: 6.2.1.5] (inferred from 100% identity to ppw:PputW619_3509)

MetaCyc: 77% identical to succinyl-CoA synthetase subunit beta (Escherichia coli K-12 substr. MG1655)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] beta chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.5

Use Curated BLAST to search for 6.2.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FB2 at UniProt or InterPro

Protein Sequence (388 amino acids)

>PP_4186 succinyl-CoA synthetase, beta subunit glutaryl-CoA synthetase, beta subunit (Pseudomonas putida KT2440)
MNLHEYQGKQLFAEYGLPVSKGFAVDTPEQAAEACDKIGGNEWVVKAQVHAGGRGKAGGV
KLVRSKEDAKAFAAQWLGKNLVTYQTDANGQPVSKILVESCTDIAKELYLGAVVDRSSRR
IVFMASTEGGVDIEKVAHETPEKILKATIDPLVGAQPFQGRELAFQLGLEGKQVQQFAKI
FVGLAKLFKDHDLALLEVNPLVIKADGDLHCLDAKINIDANAMYRQPKLKTFHDPSQDDA
REAHAAKFELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDSNVAAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAELGAKV
LAESGLNIIAATSLTDAAQQVVKAAEGK