Protein Info for PP_4173 in Pseudomonas putida KT2440

Annotation: Sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details PF09984: sCache_4" amino acids 36 to 102 (67 residues), 33.2 bits, see alignment E=1.1e-11 PF00672: HAMP" amino acids 188 to 239 (52 residues), 36.2 bits, see alignment 1.5e-12 PF00512: HisKA" amino acids 264 to 327 (64 residues), 74.3 bits, see alignment E=1.7e-24 PF02518: HATPase_c" amino acids 377 to 492 (116 residues), 95.9 bits, see alignment E=5.1e-31 PF00072: Response_reg" amino acids 517 to 628 (112 residues), 96.9 bits, see alignment E=2.1e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4173)

Predicted SEED Role

"Sensor histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FC5 at UniProt or InterPro

Protein Sequence (643 amino acids)

>PP_4173 Sensor histidine kinase/response regulator (Pseudomonas putida KT2440)
MSKRLSWDIHTRTQIISLGPALLLTLLLISFFTFVRIQDLRQELNHTGQLIANQLAPASE
YGVISGNNEVLEGLMRATLSIPHVRFLEVQDSRNHILVYVEQSDESANRAQQVEVFQAPI
RLQQIRLDNDFLQQGKATSPAIGDDYLGRVIVGMSDDAFSQRQQEIVIKAGILALFALLF
TFLLARRLALSLAKPISDMGHAVKAIQQGEYNTPLPVVDDSELGHLARHINNLASALEQA
SDEQKQAIAELIQAREEAEQANRAKSDFLAMMSHELRTPMNGVLGMLQLLETTPLSSEQA
DYTAVASESTGHLLKVINDILDFSRIERAALQLEHIDFNLGELITNSVQSFQHSAQQRGL
GLHLQLPAGIEQLQVNGDPTRIRQILLNLIGNALKFTERGQVQVDARWQVLDRQLIWLTC
SVRDTGIGIDSDRLEMMFVAFQQADSSISRRYGGTGLGLSIARTLAERMGGKLRGESREG
LGSTFTLEMPLALANPAPVPLTPPTTVRTTVPDNDQVLLVEDNPVNRSVVEAMLRSLGLA
VCTAEDGLEAVELVGRQRFAAVLMDCRLPHLDGYEATRRIRQLPNGAGLPIIALTANALQ
GDRERCMAAGMDDYLSKPLRRTELQQVLQRWLPGQTTATGDKC