Protein Info for PP_4141 in Pseudomonas putida KT2440

Annotation: DNA polymerase III subunit epsilon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR00573: exonuclease, DNA polymerase III, epsilon subunit family" amino acids 6 to 191 (186 residues), 213.8 bits, see alignment E=2.2e-67 TIGR01406: DNA polymerase III, epsilon subunit" amino acids 8 to 244 (237 residues), 292.1 bits, see alignment E=3.1e-91 PF00929: RNase_T" amino acids 10 to 173 (164 residues), 137.1 bits, see alignment E=4.4e-44

Best Hits

Swiss-Prot: 56% identical to DPO3E_SALTI: DNA polymerase III subunit epsilon (dnaQ) from Salmonella typhi

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 99% identity to ppf:Pput_1724)

MetaCyc: 55% identical to DNA polymerase III subunit epsilon (Escherichia coli K-12 substr. MG1655)
3.1.11.-

Predicted SEED Role

"DNA polymerase III epsilon subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FF6 at UniProt or InterPro

Protein Sequence (252 amino acids)

>PP_4141 DNA polymerase III subunit epsilon (Pseudomonas putida KT2440)
MEQQQDKRFVILDTETTGMPVGEGHRIIEIGCVEVIGRRLTGRHFHVYLQPDRESDEGAI
NVHGITDAFLVGKPRFGDVAEEFFQFIQGATLVIHNAAFDVGFINNEFALLGQQDRADIS
QHCTILDTLLLARSRHPGQRNSLDALCKRYDIDNSGRELHGALLDSELLADVYLAMTGGQ
TSLSLAGNGADTEEDGQGAGGSEIRRIVGRAPGRVIMASAEELEAHAERLAAIAKSAGGP
SLWQALTETPAG