Protein Info for PP_4118 in Pseudomonas putida KT2440

Annotation: putative Membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 76 to 104 (29 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 146 to 174 (29 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details PF07947: YhhN" amino acids 42 to 211 (170 residues), 128.2 bits, see alignment E=1.5e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4118)

Predicted SEED Role

"POSSIBLE MEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FH8 at UniProt or InterPro

Protein Sequence (231 amino acids)

>PP_4118 putative Membrane protein (Pseudomonas putida KT2440)
MLVAAQQQGPPMPRPSHLMILALTAAALYIYALASDNTMLALMAKPIPVLALIAWLRSTP
VSPYRTWISIGLGFSVLGDILLAIPADLFVFGLAAFLCAHLAYLRGYCGITLRPALPALI
FSAITGIALLGVLASNGLGPLLIPVALYALAISAMLWRALACGGVAALGAGLFVFSDSLI
GIDRFISPFAAAPYLIILAYWLGQWAIASSVGHRSTDKVLTQSGARRTESC