Protein Info for PP_4106 in Pseudomonas putida KT2440

Annotation: gamma-aminobutyrate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 157 to 181 (25 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 362 to 382 (21 residues), see Phobius details amino acids 403 to 425 (23 residues), see Phobius details amino acids 431 to 448 (18 residues), see Phobius details PF13520: AA_permease_2" amino acids 20 to 420 (401 residues), 112.2 bits, see alignment E=3.1e-36 PF00324: AA_permease" amino acids 21 to 442 (422 residues), 375.6 bits, see alignment E=3.5e-116

Best Hits

Swiss-Prot: 62% identical to GABP_ECOLI: GABA permease (gabP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4106)

MetaCyc: 62% identical to 4-aminobutanoate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-384; TRANS-RXN-57

Predicted SEED Role

"gamma-aminobutyrate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FI9 at UniProt or InterPro

Protein Sequence (460 amino acids)

>PP_4106 gamma-aminobutyrate permease (Pseudomonas putida KT2440)
MASQDNKKQRSLQHGLTSRQVSMISIAGIIGAGLFIGSSNAIATAGPAILISYAMTGLLV
LLVMRMLGEMAIANPNSGSFSTYASEAIGPWAGFTIGWLYWWFWVLIIPVEAIAGADILH
AYFPGVPSWLFAFLIMLVLSGTNLVSVKNFGAFEYWFALVKVVAIIGFIGVCTLAVFGFW
PLAEVSGVSRLWDSGGFMPNGFGTVLGGVLITIFSFFGAEIVTIAADETANPKDKIRRAT
NLVVYRIAIFYLASIFLVVSLVAWNDPGLKAVGSFQRVLEVLNVPGAKLLVDLVVLVAVT
SCMNSGLYTASRMLYSLGARGQALSVTKRISGSGVPTVAVIFSTLAGFAGCFVNYVFPGK
VFGFLLSTTGAIALLVYLVIAVSQLRMRARAEREGRPLELKMWLFPWLTWLVIGTIVMVL
GYMLFSDAYRYETLMTAGVTAFILLVSLTQRRAKMVAQTA