Protein Info for PP_4072 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 TIGR03362: type VI secretion-associated protein, VC_A0119 family" amino acids 12 to 473 (462 residues), 489 bits, see alignment E=9.3e-151 PF06812: ImpA_N" amino acids 16 to 129 (114 residues), 82.7 bits, see alignment E=2.3e-27 PF16989: T6SS_VasJ" amino acids 224 to 472 (249 residues), 221.9 bits, see alignment E=1e-69

Best Hits

KEGG orthology group: K11910, type VI secretion system protein VasJ (inferred from 100% identity to ppu:PP_4072)

Predicted SEED Role

"Uncharacterized protein ImpA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FL7 at UniProt or InterPro

Protein Sequence (488 amino acids)

>PP_4072 conserved protein of unknown function (Pseudomonas putida KT2440)
MSLVADVEAQEITRLLAPIDAQVPAGLFDGEDETYQAIDQEMVKLGGLQEASIDWDYIEE
ASAQYLERQCKHLRIVAHLSVAWLRSGCWERWGFTLALLGGMIDNYWETAHPTPGPKGFL
TKRKIVGLLFNRLIDALPRLDRFTYTPAHAAAAKGALARLLRQQEAAQLAPAVLVELERL
LHKHTALANGIGERDAPKAPVESPQPAPLADVIATPKPCLSGGNERETRRAILSMAELIN
QQDPYDPTGYQLRRFGLWAHIQAAPQTRQCNRTELMAVPRDIASDYEEAIAGTVIDAALL
QRVEKSVSASPFWIRGSFLAATAASRLAMGEVAEAIRAATARFVLRMPALQQLCFSDGRV
FVDDQCLAWLKGADGQSEQAEASQEFTSLREELVSQLESGGVEPVLLRLQGMQADFRAPR
ERCHTTLIAADLLAARGVSWLAQDLCAGVARTMQQTTASDWEPEVFQRLQQYASSHVLAD
RNKEQEPR