Protein Info for PP_4033 in Pseudomonas putida KT2440

Annotation: Ribonuclease Z

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF00753: Lactamase_B" amino acids 22 to 104 (83 residues), 40.1 bits, see alignment E=4e-14 PF12706: Lactamase_B_2" amino acids 31 to 149 (119 residues), 40.7 bits, see alignment E=2.1e-14

Best Hits

Swiss-Prot: 100% identical to RNZ_PSEPK: Ribonuclease Z (rnz) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00784, ribonuclease Z [EC: 3.1.26.11] (inferred from 100% identity to ppu:PP_4033)

Predicted SEED Role

"Ribonuclease Z (EC 3.1.26.11)" in subsystem tRNA processing (EC 3.1.26.11)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FQ4 at UniProt or InterPro

Protein Sequence (319 amino acids)

>PP_4033 Ribonuclease Z (Pseudomonas putida KT2440)
MDLLFLGTSAGVPTKARNVSATAVIEASGSHWYLVDCGEGTQHRLLHTPLSIRDLRAIFI
THVHGDHCFGLPGLLASAGMSGRTQPLEVILPAVLHDWVRQGLVASDTFLPFELRLLPVE
ELIAWRSETLQVTTVQLSHRVPSVGFVFTEINPEPRLDIQRLDAEGITRGPLWGELAKGL
TVTYDGQLLNGNDYLRPSRPPRRVIVCGDNDKPELLAAVARGADVLVHEATFTQAVVERT
GGTFGHSTAAEVARFAEAAGVRNLVLTHFSARYQNDPRRSPHIDNVRDEALAHYSGQLTL
AQDLQRYHLGRNGLLEASA