Protein Info for PP_4032 in Pseudomonas putida KT2440

Annotation: putative Outer membrane lipoprotein Blc

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF08212: Lipocalin_2" amino acids 33 to 179 (147 residues), 214 bits, see alignment E=4.4e-68

Best Hits

KEGG orthology group: K03098, outer membrane lipoprotein Blc (inferred from 99% identity to ppf:Pput_1806)

Predicted SEED Role

"Outer membrane lipoprotein Blc"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FQ5 at UniProt or InterPro

Protein Sequence (181 amino acids)

>PP_4032 putative Outer membrane lipoprotein Blc (Pseudomonas putida KT2440)
MALRTTLLLSCMTLALLGCAGNDHPAPPRTQQVDLQRYQGTWYELARLPMFFQRNCVKSE
ARYGLREDGRIDVTNRCQEKDGQWNEAKGIAEAQQPGSTDKLWVRFDNWFSRLAPGLTKG
EYWVLYHDKDYRVALVGHPNREYLWLLSRTPAVTDQQREQLLTIARDQGYDTSKLIWRQD
N