Protein Info for PP_4029 in Pseudomonas putida KT2440

Annotation: NADH pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF09296: NUDIX-like" amino acids 20 to 105 (86 residues), 56.9 bits, see alignment E=4.6e-19 PF09297: zf-NADH-PPase" amino acids 107 to 138 (32 residues), 42.3 bits, see alignment 7.1e-15 PF00293: NUDIX" amino acids 144 to 259 (116 residues), 81.3 bits, see alignment E=1e-26

Best Hits

Swiss-Prot: 100% identical to NUDC_PSEPK: NADH pyrophosphatase (nudC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03426, NAD+ diphosphatase [EC: 3.6.1.22] (inferred from 100% identity to ppu:PP_4029)

Predicted SEED Role

"NADH pyrophosphatase (EC 3.6.1.22)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FQ8 at UniProt or InterPro

Protein Sequence (276 amino acids)

>PP_4029 NADH pyrophosphatase (Pseudomonas putida KT2440)
MSARWTTAVLDPQMTGGLAVARSPEGFLVDANGALFPRDWLKRQDLDVLCEHGIGHFDGQ
PVFLLELRSATDVPGCSWRGLRAFMLEGDFDTYKVLGYAAQIGTWAREHRFCGSCGQPMT
QIRWERAMYCQPCDLRSYPRISPSMIVLVTRGDEILLARSPRFVTGVYSTLAGFAEPGES
AEDCLVREVREEVAVEVKNIQYVGSQCWPFPHSMMLGFHAEYAGGEIVMQPDEIEDAKWF
SVHDLPPLPAGRSIARYLIDLYVARRLGCDIPAFPS