Protein Info for PP_4021 in Pseudomonas putida KT2440

Annotation: non-heme chloroperoxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF02129: Peptidase_S15" amino acids 21 to 233 (213 residues), 23.6 bits, see alignment E=9.8e-09 PF00561: Abhydrolase_1" amino acids 23 to 256 (234 residues), 105.5 bits, see alignment E=9.1e-34 PF12146: Hydrolase_4" amino acids 24 to 124 (101 residues), 54 bits, see alignment E=3.8e-18 PF12697: Abhydrolase_6" amino acids 27 to 266 (240 residues), 67 bits, see alignment E=1e-21

Best Hits

Swiss-Prot: 69% identical to PRXC_BURPY: Non-heme chloroperoxidase (cpo) from Burkholderia pyrrocinia

KEGG orthology group: K00433, chloride peroxidase [EC: 1.11.1.10] (inferred from 100% identity to ppu:PP_4021)

Predicted SEED Role

"Non-heme chloroperoxidase (EC 1.11.1.10)" (EC 1.11.1.10)

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.10

Use Curated BLAST to search for 1.11.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FR2 at UniProt or InterPro

Protein Sequence (276 amino acids)

>PP_4021 non-heme chloroperoxidase (Pseudomonas putida KT2440)
MSYVTTKDGVQIFYKDWGPRDAPVIHFHHGWPLSADDWDAQMLFFLAEGYRVVAHDRRGH
GRSSQVWNGHDMDHYADDVAAVVAHLGTQGAVHVGHSTGGGEVVRYMARYPEDKVAKAVL
IAAVPPLMVQTPGNPGGLPKSVFDGFQAQVASNRAQFYRDVPTGPFYGYNRPGVDASEGI
IGNWWRQGMIGSAKAHYDGIVAFSQTDFTEDLKGIQQPVLVMHGDDDQIVPYENSGVLSA
KLLPNGTLKTYEGYPHGMPTTHADVINADLLAFIQS