Protein Info for PP_3992 in Pseudomonas putida KT2440

Annotation: xanthine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 27 to 53 (27 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 152 to 175 (24 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 345 to 367 (23 residues), see Phobius details amino acids 373 to 394 (22 residues), see Phobius details amino acids 402 to 421 (20 residues), see Phobius details amino acids 432 to 452 (21 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 31 to 421 (391 residues), 322.4 bits, see alignment E=1.8e-100 TIGR00801: uracil-xanthine permease" amino acids 31 to 449 (419 residues), 401.5 bits, see alignment E=4.4e-124 TIGR03173: xanthine permease" amino acids 34 to 453 (420 residues), 422.1 bits, see alignment E=2e-130

Best Hits

Swiss-Prot: 46% identical to XANQ_ECOL6: Xanthine permease XanQ (xanQ) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03458, nucleobase:cation symporter-2, NCS2 family (inferred from 100% identity to ppu:PP_3992)

MetaCyc: 46% identical to xanthine:H+ symporter XanQ (Escherichia coli K-12 substr. MG1655)
RXN-5076

Predicted SEED Role

"Uracil-xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FU0 at UniProt or InterPro

Protein Sequence (459 amino acids)

>PP_3992 xanthine permease (Pseudomonas putida KT2440)
MSSHEHSPGAGAPANELVLGLEDKPRLLIGLLAALQHLLAIIVPIVTPGLLICQALGVSA
RDTNLIVSMSLVISGIATFVQCKRFGPFGAGLLIVQGTSFNFVGPLIAGGALMVKQGTPV
EGVMAAIFGVVIAGSFVEMGVSRILPFVKRLITPLVTGIVVLMIGLTLIKVGLISMGGGF
GAMANGTFANGENLLMSGVVLAIIVVLNRIPVVWMRSCAIVIALAVGYALAGYLGRLDFT
GMHEAALFQVPTPLHFGLGFSWALFIPMLVIYLVTSLEAIGDVTATSKVSRQPVEGPMWM
QRIKGGVLVNGANSLLAGLFNTFPSSIFAQNNGVIQLTGIASRHIGMWIAVMLVLLGLFP
SVAGVIQAVPEPVLGGAAMVMFGAVAASGINILASTRLDRRALLIIAVSLALGLGVAQVP
EFLAHMPAAIRNVLESGVATGGICALVLNWFLPEGKEQA