Protein Info for PP_3959 in Pseudomonas putida KT2440

Annotation: Voltage-gated chloride channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 159 to 185 (27 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 331 to 356 (26 residues), see Phobius details amino acids 366 to 389 (24 residues), see Phobius details amino acids 399 to 422 (24 residues), see Phobius details PF00654: Voltage_CLC" amino acids 70 to 412 (343 residues), 286.3 bits, see alignment E=1.9e-89

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3959)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FW8 at UniProt or InterPro

Protein Sequence (453 amino acids)

>PP_3959 Voltage-gated chloride channel family protein (Pseudomonas putida KT2440)
MSDPTRPAPSLPRRSRWREWRQRLAFWIGALLVGLVALAFAWLADAAFASFKRLLEWAPW
SPLLITPLGFAALAYLTQRWFENAKGSGIPQVIAALEMPSRRLRARLLSLPVAAARMSLT
LGALLVGGSVGREGPTVHIGAAVLYSFGRRLGLHGRRTIAGLVLAGGAAGIAAAFNTPLA
GVVFAIEELSRTFEQRFSGLVLTAVLIGGVVTLGLMGHYAYFGEISGRMPVDWGWSVVPA
CAVLGGLLGGFYAKLVLPTDKGILGQVCKLRGRYPVRFAATCGLLLATLGLVSGNHVFGT
GYEETRALLEGQPITDTSFLLWKFLANVASYLSGIPGGLFSPSLSIGAAFAPLLSLLPDV
DPQAGALLGMGAYLAGVTRSPLTASVIVLELTHSPDLAIPMLAATLMAAAISGWVSPVSL
YHALAKQITDKLHAAASSSTEPAARQPSTTEKP