Protein Info for PP_3943 in Pseudomonas putida KT2440

Annotation: N-formylmaleamate deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 28 to 251 (224 residues), 75.8 bits, E=6.5e-25
• PF12697: Abhydrolase_6
  • amino acids 29 to 257 (229 residues), 62.1 bits, E=1.9e-20
• PF12146: Hydrolase_4
  • amino acids 30 to 248 (219 residues), 36.5 bits, E=5.1e-13

Best Hits

Swiss-Prot: 100% identical to NICD_PSEPK: N-formylmaleamate deformylase (nicD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3943)

MetaCyc: 100% identical to N-formylmaleamate deformylase (Pseudomonas putida KT2440)
RXN-11318 [EC: 3.5.1.106]

Predicted SEED Role

"Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase" in subsystem cAMP signaling in bacteria

MetaCyc Pathways

• nicotinate degradation I (6/6 steps found)
• picolinate degradation (4/7 steps found)
• nicotine degradation II (pyrrolidine pathway) (6/11 steps found)
• nicotine degradation III (VPP pathway) (5/10 steps found)
• superpathway of nicotinate degradation (6/18 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.106

Sequence Analysis Tools

See Q88FY3 at UniProt or InterPro

Protein Sequence (268 amino acids)

>PP_3943 N-formylmaleamate deformylase (Pseudomonas putida KT2440)
MSTFVAGGNVSANGIRQHYLRYGGKGHALILVPGITSPAITWGFVAERLGHYFDTYVLDV
RGRGLSSSGPDLDYGTDACAADIPAFAAALGLDSYHLLGHSMGARFAIRAAAQGAPGLQR
LVLVDPPVSGPGRRAYPSKLPWYVDSIRQATVGMSGDDMRAFCATWSDEQLALRAEWLHT
CYEPAIVRAFDDFHEVDIHQYLPAVRQPALLMVAGRGGVIEPRDIAEMRELKPDIQVAYV
DNAGHMIPWDDLDGFFAAFGDFLDHPLV