Protein Info for PP_3922 in Pseudomonas putida KT2440

Annotation: putative inner membrane peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details PF08496: Peptidase_S49_N" amino acids 2 to 149 (148 residues), 187.6 bits, see alignment E=1.3e-59 PF01343: Peptidase_S49" amino acids 152 to 300 (149 residues), 153.7 bits, see alignment E=4e-49

Best Hits

Swiss-Prot: 50% identical to SOHB_ECOLI: Probable protease SohB (sohB) from Escherichia coli (strain K12)

KEGG orthology group: K04774, serine protease SohB [EC: 3.4.21.-] (inferred from 100% identity to ppf:Pput_1913)

Predicted SEED Role

"Peptidase, U7 family"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88G04 at UniProt or InterPro

Protein Sequence (339 amino acids)

>PP_3922 putative inner membrane peptidase (Pseudomonas putida KT2440)
MEFLAEYASFLAKTATLVIAILVVLSAIAGLRGKGRRKSGGQLQVTRLNDFYKDLRERLE
SGLLDKAQLKALRKQQAKAEKQQKKGKAEDKSRVFVLDFDGDIKASATESLRNEITALLT
LATARDEVVLRLESGGGLVHSYGLAASQLARIRQAGIPLTVCIDKVAASGGYMMACIGEK
IVSAPFAVLGSIGVVAQLPNVNRLLKKHDIDFEVLTAGEYKRTLTVFGENTEKGREKYQE
DLDITHQLFKDFVSRYRPQLHIDEVATGEVWLGVAALNRKLVDELQTSDEYLSERARNAN
LFHLHYAERKSLQERIGMAASGTVENAVVGLWSKLSRLR