Protein Info for PP_3861 in Pseudomonas putida KT2440

Annotation: Phage FluMu protein gp46

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 PF07409: GP46" amino acids 7 to 112 (106 residues), 111.3 bits, see alignment E=1e-36

Best Hits

Swiss-Prot: 46% identical to BP46_BPMU: Baseplate protein gp46 (Mup46) from Escherichia phage Mu

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3861)

Predicted SEED Role

"Bacteriophage protein GP46"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88G64 at UniProt or InterPro

Protein Sequence (128 amino acids)

>PP_3861 Phage FluMu protein gp46 (Pseudomonas putida KT2440)
MSREPLLRRAVTISLFSWRRAASDDALDDADRQGWWGDCAPSEAGDQIGSRLWLLHRRAL
TDDTLRDAREYAEEALRWMIDDEIVTTVTVTAERLGNDRLNLMVLLTELNGETLKLAFED
TWSLINAV