Protein Info for PP_3837 in Pseudomonas putida KT2440

Annotation: inner membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details PF07291: MauE" amino acids 11 to 90 (80 residues), 30.6 bits, see alignment E=5.6e-11 PF07681: DoxX" amino acids 14 to 94 (81 residues), 75.9 bits, see alignment E=4.8e-25 PF02077: SURF4" amino acids 57 to 136 (80 residues), 41.7 bits, see alignment E=1.6e-14

Best Hits

Swiss-Prot: 53% identical to YPHA_SHIFL: Inner membrane protein YphA (yphA) from Shigella flexneri

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_1934)

Predicted SEED Role

"Inner membrane protein YphA" in subsystem Unknown sugar utilization (cluster yphABCDEFG)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88G88 at UniProt or InterPro

Protein Sequence (137 amino acids)

>PP_3837 inner membrane protein of unknown function (Pseudomonas putida KT2440)
MRYSLFDGQRDIIILIARVLLMVLFVLSGWAKLTGFDGTVGYMTSLGAPAPMLAAGIAVI
MEFLVAILLILGFYTRPLAFLFALFVLGTALLGHPFWNMVDPERSANMTQFLKNLSIMGG
LLLLAVSGPGRFSVDGR