Protein Info for PP_3827 in Pseudomonas putida KT2440

Annotation: 2-nitropropane dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 transmembrane" amino acids 229 to 248 (20 residues), see Phobius details PF03060: NMO" amino acids 10 to 348 (339 residues), 251.8 bits, see alignment E=1.8e-78 PF04481: DUF561" amino acids 156 to 245 (90 residues), 22.8 bits, see alignment E=7.3e-09

Best Hits

KEGG orthology group: K00459, nitronate monooxygenase [EC: 1.13.12.16] (inferred from 100% identity to ppu:PP_3827)

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [FMN] (EC 1.3.1.9)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.12.16 or 1.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88G98 at UniProt or InterPro

Protein Sequence (361 amino acids)

>PP_3827 2-nitropropane dioxygenase (Pseudomonas putida KT2440)
MSHWPDRRILNLLGIELPILQAPMAGATGSAMAIAVGQAGGLGALPCAMLSGEQVRAEIA
AFRAGCPGRPLNLNFFCHQPPAPDAERDARWKQALEPYYSEVGADFTAPTPVSNRAPFDE
QSCLLVEALRPEVVSFHFGLPQAELLQRVKASGAKVLSSATTVEEAAWLERNGCDAIIAM
GYEAGGHRGMFLSDDITSQIGTFALVPQVADAVGVPVIAAGGIGDHRGLLAALALGASAV
QIGTAYLFCPEAKVSPAHRQALDSAPASDTALTNLFTGRPARGINNRLMRELGPMSELAP
RFPLAGGALMPLRAITDPQGKSDFSNLWSGQALRLGRHMPAGELTREIAGKALAVIGHQA
F