Protein Info for PP_3821 in Pseudomonas putida KT2440

Annotation: UTP-glucose-1-phosphate uridylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 TIGR01099: UTP--glucose-1-phosphate uridylyltransferase" amino acids 2 to 264 (263 residues), 399.1 bits, see alignment E=4.7e-124 PF00483: NTP_transferase" amino acids 9 to 268 (260 residues), 118.4 bits, see alignment E=1.9e-38

Best Hits

Swiss-Prot: 89% identical to GALU2_PSEAI: UTP--glucose-1-phosphate uridylyltransferase (galU) from Pseudomonas aeruginosa

KEGG orthology group: K00963, UTP--glucose-1-phosphate uridylyltransferase [EC: 2.7.7.9] (inferred from 100% identity to ppu:PP_3821)

MetaCyc: 44% identical to UDP-glucose pyrophosphorylase (Mycoplasmoides pneumoniae M129)
UTP-monosaccharide-1-phosphate uridylyltransferase. [EC: 2.7.7.64, 2.7.7.9]

Predicted SEED Role

"UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)" (EC 2.7.7.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.64 or 2.7.7.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GA4 at UniProt or InterPro

Protein Sequence (279 amino acids)

>PP_3821 UTP-glucose-1-phosphate uridylyltransferase (Pseudomonas putida KT2440)
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVTGRGKR
ALEDHFDISYELENQIKGTDKEKYLVGIRRLLNECSFSYTRQTEMKGLGHAILTGRPLIG
DEPFAVVLADDLCVNPEGDGVLTQMVKLYKQYRCSIVAIQEVDPQETNKYGVIAGEMIRD
DIFRVTNMVEKPAPEDAPSNLAIIGRYILTPDIFDIIANTKPGKGGEIQITDALLQQAKD
GCVIAYKFKGKRFDCGGAEGYIDATNFCFENYYKTGKAY