Protein Info for PP_3818 in Pseudomonas putida KT2440

Annotation: Periplamic phosphate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF12849: PBP_like_2" amino acids 59 to 287 (229 residues), 102.1 bits, see alignment E=9.1e-33 PF12727: PBP_like" amino acids 72 to 230 (159 residues), 32.5 bits, see alignment E=9.7e-12 PF13531: SBP_bac_11" amino acids 78 to 298 (221 residues), 25.4 bits, see alignment E=2.2e-09 PF00691: OmpA" amino acids 333 to 428 (96 residues), 42.9 bits, see alignment E=1e-14

Best Hits

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 100% identity to ppu:PP_3818)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GA6 at UniProt or InterPro

Protein Sequence (435 amino acids)

>PP_3818 Periplamic phosphate-binding protein (Pseudomonas putida KT2440)
MLRLLVLLLTLLPLATLAEPLHLRVQGSNTIGAALLPALVQGQLRAQQATAIEQQQGKVA
NEWVITARDGHGQPLRIDIAAHGSSTGFVALGRGDADLAASSRPINDSEVRQLQALGDLR
AAGAEQVIGLDGVAVIVHPDNPIPQLNIRQLAHIFSGQIQRWEQLGIPGGAIHLYARDDR
SGTFETFKALVLEPQQGELSAKARRFESSDELAARVGTDRQAIGFSSLAAVHGAKVLAVA
EGDAPAMLPERARVASEDYPLSRRLYFYLPANPKPQAKALVDFAQSPAGQAIIAQQGFVS
QQIKALSVAPQSDMPPPYRTLARQAQRLSVNFRFQEGSASLDNKALRDVQRVTEYLRQAG
KLQGKAVLVGFGDPKETPGRAALLSRLRAQAVRRELARGGVEVLQVTGMGDELPVAGNEL
EQGRLRNRRVEVWVY