Protein Info for PP_3815 in Pseudomonas putida KT2440

Annotation: Polyamine ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 40 to 62 (23 residues), see Phobius details amino acids 85 to 111 (27 residues), see Phobius details amino acids 121 to 145 (25 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 269 to 293 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 103 to 295 (193 residues), 32.9 bits, see alignment E=2.8e-12

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to ppu:PP_3815)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GA9 at UniProt or InterPro

Protein Sequence (305 amino acids)

>PP_3815 Polyamine ABC transporter, permease protein (Pseudomonas putida KT2440)
MKVAINALHNAQGTPTGAGAPGTTPRRASLSQRWKGSRNLLPALLFLGVFFFAPLVGLLL
RGVLEPTPGLGNYEQLFANSAYARVLFNTFSVAGVVTLISVLLGFPLAWAITLVPKGWGR
WLLNIVLLSMWTSLLARTYSWLVLLQSSGVINKALMAMGIIDAPLEMVHNLTGVVIGMSY
IMIPFIVLPLQATMHAIDPMVLQAGSICGASPWTNFWKVFLPLCRSGLFSGALMVFVMSL
GYYVTPALLGGAQNMMLPEFIIQQVQSFLNWGLASAAAALLVAITLVLFYLYLKLQPESP
VGNAR