Protein Info for PP_3803 in Pseudomonas putida KT2440

Annotation: putative Cation ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 269 to 291 (23 residues), see Phobius details PF00950: ABC-3" amino acids 25 to 285 (261 residues), 173.5 bits, see alignment E=6.4e-55 PF01032: FecCD" amino acids 62 to 284 (223 residues), 43 bits, see alignment E=3.1e-15

Best Hits

KEGG orthology group: K09816, zinc transport system permease protein (inferred from 99% identity to ppg:PputGB1_2113)

Predicted SEED Role

"ABC transporter in pyoverdin gene cluster, permease component" in subsystem Siderophore Pyoverdine

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GC1 at UniProt or InterPro

Protein Sequence (299 amino acids)

>PP_3803 putative Cation ABC transporter, permease protein (Pseudomonas putida KT2440)
MSFEIFRQTVQDWATAGYLPEALAYGFVVNALLAGLMIGPVLGGLGTLVVVKRFAFFSEA
VGHAALTGVAIGILLGEPYTGPYGSLFGYCLLFGILLNFLRNRTGLSPDTLIGVFLSVSL
ALGASLLLMLAGKINVHILENVLFGSVLTVSAQDLLVLGIVAVLVLALALPLYNRIMLAS
FNPQLAAVRGVAVKTLDYLFVVLVTLVTVAAVKVIGAILVGALLVIPAAAARLVSQSLKG
FFFLSVLIATISTLFGILLPIVFDLPVPSGAAIILVAGICFALAALARALVPRLQGNPA