Protein Info for PP_3789 in Pseudomonas putida KT2440

Annotation: putative Efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 49 to 73 (25 residues), see Phobius details amino acids 80 to 130 (51 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 219 to 244 (26 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 286 to 302 (17 residues), see Phobius details amino acids 308 to 328 (21 residues), see Phobius details amino acids 345 to 369 (25 residues), see Phobius details amino acids 374 to 392 (19 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 360 (342 residues), 93.4 bits, see alignment E=7.1e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3789)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GD5 at UniProt or InterPro

Protein Sequence (406 amino acids)

>PP_3789 putative Efflux transporter (Pseudomonas putida KT2440)
MQPMSILSWSRPHSPLHSLLLGSLLHDASKGIASPLMVLLLTTRFGLNSWQTGALLGISM
LLATLMSLPAGLLFDRFARLHLATITLLLMTLAVGLLPFAQIILLVSLLLVFMEFAAALF
GIGLKALLADFVSVKQRVSAFSYRYILTNVAFAIGPVLGVRLAEVSLTLALLVAAGACGA
AMVVMMCLGASQGQPRTSLKTGAPSLADALKVLGNDRNLVLYTLGSFFNTVVHGRFTFFL
SLWLLYQYPANQGMEMLSWLLLTNAITVIALQRLVSRYITLETLNSRVMMGALLFSIGLL
GFSVSEQLTAWCLSMLVFTLGELLIQPAEYLYIDSISPPPLKGSYFAAHNLASLGAAVSP
AWCGFILSLAGPQGLCFSLIACVLAGSSLCAMRPRLTPGNFARGDL