Protein Info for PP_3788 in Pseudomonas putida KT2440

Annotation: putative Non-ribosomal peptide synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 transmembrane" amino acids 81 to 102 (22 residues), see Phobius details PF00501: AMP-binding" amino acids 26 to 369 (344 residues), 238.8 bits, see alignment E=9e-75 TIGR01733: amino acid adenylation domain" amino acids 45 to 444 (400 residues), 359.3 bits, see alignment E=1.3e-111

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3788)

Predicted SEED Role

"Non-ribosomal peptide synthetase modules, pyoverdine" in subsystem Siderophore Pyoverdine

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GD6 at UniProt or InterPro

Protein Sequence (517 amino acids)

>PP_3788 putative Non-ribosomal peptide synthetase (Pseudomonas putida KT2440)
MNQALLTITGGPAYPVHFSLVEYIERIIHRYPSNAAAFDEDQRLTYSELRIELLTLHARL
HELGVRSGDVVAVNATVQLRYPVVVLGLLLAGLVYLPIAAALPPERKRAICEQARPALMI
TDEQKPDDAIPTCTLSSLFSGKPVGAAFDLFPEPSPEATAYLIFTSGSTGVPKGVSITRK
GFFNRLQWAQDYYALGSEDVTALKTQASFDPSIQEAVLPFFSAGAVFVPDHNRVNFPNYL
SACIAEHGVTMLIMVPSHLQHLLASPAINACQHLRHIVCCGEPWGVELISALHQRLPNCR
IYNGYGPTEATIGTLVFNPPRGYASDVIPIGKPIAGTHVCIVDEDLQPVPTGEAGELIIG
GICVGDGYLNNAPLTEQRFRRLQVEGAGEVRFYLSGDVARALPTGDIVFLGRRDNQVKIN
GVRIELEEIELALRNCPGVRDAIVVKRKGKVSDELHAFLIAHMPLDIQAITTSCARRIGQ
ATTPSRFSQVEAFPLNQSGKVDRRALAATLMNQRSLP