Protein Info for PP_3751 in Pseudomonas putida KT2440

Annotation: putative Cyanate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 127 to 150 (24 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 337 (316 residues), 101 bits, see alignment E=3.3e-33

Best Hits

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 99% identity to ppf:Pput_2012)

Predicted SEED Role

"Cyanate transport protein CynX" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GH2 at UniProt or InterPro

Protein Sequence (398 amino acids)

>PP_3751 putative Cyanate transporter (Pseudomonas putida KT2440)
MSAVLNLLLVILLALNLRPILTSIGPLLEPMRASTGLGYQQAALLTALPVLCMGLVPLLQ
PWLRRWVSEHGGMLGGLAAIALACLWRLQLDSAWALIASALVAGLGVAVVQGMMPGLVNR
WFPGRLAGAMGLYSAALMSGGGLAAVLGPHISGHFGYWQAGLGVWAVPAVLAVLAWAVLR
PRQEAPKLSGAAGGHWFGTRRAWLLALYFGLINGGYTSMVAWLPAYHIEHGGSAQGGADL
VGLMTVFQVLGALGLPLLLRRWADRRPGLWLALAIQLAGFLGLLLAPAAASGLWVAMIGF
GLGACFSQCLTLTLEHLKTPAEAGSLAAFVQGIGFIITGIVPYITGWLRDVSGDFQASWT
LLTVTVMAMLLVTACFNPRGYAAAIARPAATGKAAPIN