Protein Info for PP_3728 in Pseudomonas putida KT2440

Annotation: Sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details PF17149: CHASE5" amino acids 36 to 142 (107 residues), 52 bits, see alignment E=1.5e-17 PF00512: HisKA" amino acids 267 to 332 (66 residues), 64.5 bits, see alignment E=1.9e-21 PF02518: HATPase_c" amino acids 381 to 494 (114 residues), 103.5 bits, see alignment E=2.2e-33 PF00072: Response_reg" amino acids 514 to 626 (113 residues), 78.1 bits, see alignment E=1.4e-25 PF01627: Hpt" amino acids 661 to 739 (79 residues), 42 bits, see alignment E=2.2e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3728)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GJ4 at UniProt or InterPro

Protein Sequence (750 amino acids)

>PP_3728 Sensor histidine kinase/response regulator (Pseudomonas putida KT2440)
MIRLHTDGLLRRLLRFILLFSLCFTVLASSVQLYFEYRREMRDIEARMALIRAGYLASLE
RSLWDLDEAQLDTQLRGLVDFSDVARVRLVSDDFQLLRGEAEPKGPLRIERFPLDYQPPS
GPARHLGELEVSIDLGAVHHRLYATGLASLLWMGVFLCGLAVALSGLFYRLVTRHLQVMA
EFARRIGAGQWQEPLRLGRRRSSRPDEIDTVANALDDMRRAILSDIERRERDRLELQDKR
DELQAMVERRTASLARAKDEAEAANLAKSRFLATMSHELRTPLNGILGMAELLRGGRLEV
ADRQRVEALYKAGEGLLAILNEVLYFARLEEGESRAERVVFSLRQLCQEVLALLEPMAME
NADTLQLQVDEQLAAYQYGAEQYLRQVLSNLLANAIKFTEHGQVQLTVQVLANNECSQRL
RLSVRDNGIGIEPAVQAKIFDRFVQASEAVTQRYGGTGLGLAICKHLVEKLGGSIGLESV
QGQGSCFWFELDMARGQPVSAGSPAPSPLPSLDILVVEDVALNREVAGGLLMRDGHRVSF
AEDASQALQACAQRRFDLVLLDVHLPGMSGVALCRQLRSSPGPNRHSRILALTAGVQPGQ
VAGYLDAGMQGVLAKPLRLDSLRKALADVAPGEVASAGADMDWSLLDTHRSLLGEQKLQG
LLKVLRQSLQQHATALAEALPAQDFTEVLHLAHRLAGSCDSLGFTGLATVLRGLEEAARQ
HDVQAMQALGEPLATQLGQASATLEQLIQS