Protein Info for PP_3661 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function, UPF0324 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 70 to 93 (24 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 326 to 348 (23 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 22 to 329 (308 residues), 291.6 bits, see alignment E=2.9e-91 TIGR00698: conserved hypothetical protein" amino acids 22 to 352 (331 residues), 248.1 bits, see alignment E=7e-78

Best Hits

Swiss-Prot: 100% identical to Y3661_PSEPK: UPF0324 membrane protein PP_3661 (PP_3661) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_2068)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GQ7 at UniProt or InterPro

Protein Sequence (353 amino acids)

>PP_3661 conserved membrane protein of unknown function, UPF0324 family (Pseudomonas putida KT2440)
MATVPSNPAFAPTLSTRGRLNGILFVALFAVAVTQLAAMPAIANLGISPLIVGIVAGALY
GNALRDGVPASWAAGINFSARGLLRIAVAFFGLRVSLQEIAEVGWSGLIVSVLVVTSTLL
IGLWCGMKVFKLDRDTALLTAAGSAICGAAAVLAFESALRSAPHKSAMAVGSVVLFGTLS
MFLYPLAINAGWLHLDTMGAGLLLGGTVHEVAQVVGAASNVSPEATHVATIVKMTRVMLL
VPVLLVVGLWISRSRKAGQAQGNGRIAMPWFAFGFLALVLVNSMQVLPGSVTQAVNSLDT
FALTMAMTALGMETRFSQIRQAGPRALATGAILNLWLVGGGLAITLGVQKLLG